Submit manuscript...
MOJ
eISSN: 2575-9094

Drug Design Development & Therapy

Research Article Volume 2 Issue 2

Insights into the misfolding of α–synuclein in the presence of metal ions: a simulation study

Nataraj Sekhar Pagadala

Department of elecrical and computer engineering, University of Alberta, Canada

Correspondence: Nataraj Sekhar Pagadala, Department of elecrical and computer engineering, University of Alberta, Canada

Received: April 03, 2018 | Published: April 19, 2018

Citation: Pagadala NS. Insights into the misfolding of α-synuclein in the presence of metal ions: a simulation study. MOJ Drug Des Develop Ther. 2018;2(2):56-65. DOI: 10.15406/mojddt.2018.02.00030

Download PDF

Abstract

Molecular dynamics of α‒synuclein in the presence of five different salt concentrations show that Zn2+ enhanced the stability of the protein monomer while K+ shows opposite effect. Higher regions of α‒synuclein unfolding was seen between the residues 100‒140 in the presence of NaCl and KCl while the presence of CaCl2 and MgCl2 results in similar unfolding between the residues 60‒80. In contrast, the unfolding of α‒synuclein in the presence of ZnCl2 deviate from other salts indicating the influence of Zn2+ in the unfolding of the secondary and tertiary structures of α‒synuclein. In protein dimers, these misfolding of α‒synuclein are commonly seen between the residues 80‒100 in all these five salts indicating that the NAC region of the dimer is mainly involved in protein unfolding. Mutation of Ala30Pro clearly shows that decreased the stability of α‒synuclein monomer while Ca2+ influenced protein aggregation in protein dimer. Removing the residues from 110‒140 reduced the stability of monomer in the presence of K+ while shows higher stability with Ca2+ in the protein dimer. However, both Na+ and Miens show variations in different forms of the protein. These results show that α‒synuclein is less prone to aggregation in the presence of Zn2+ which may have implications for the prevention and therapeutics of the Parkinson’s disease.

Keywords: a‒synuclein, simulations, fibrillization, circular dichroism, oligomerization

Introduction

Parkinson’s disease is a degenerative neurological disease of the central nervous system characterized by rigidity, tremors, and bradykinesia. It is the most common form of age‒cognate neurodegenerative disorder after Alzheimer’s that is associated in formation of amyloid‒like fibrils at neuronal surfaces.1,2 This is caused by the loss of dopaminergic neurons in the brain. A molecular hallmark of PD is the accumulation of protein aggregates called as Lewy bodies that play an important role in neuronal loss. A major component of these aggregates is the natively unfolded for of the protein α‒synuclein in solution. The disease is also linked with two mutations (A30P and A53T) which seem to endow α‒synuclein with a higher propensity to form aggregates in the substantia nigra.3 Fibrillization of α‒synuclein is the major component of Lewy bodies (LBs) and Lewy neuritis (LNs) that leads to the pathogenesis of the disease.4,5 Since these amyloid fibrils are highly insoluble and non‒crystalline, the details of protein aggregation at the atomic level are still difficult to obtain.6,7 Circular dichroism (CD) and other optical methods reveal that α‒synuclein is highly unstructured and is very sensitive to environmental conditions such as pH, temperature, density, presence of metal ions, micelles, and lipid bi‒layer membranes.8‒13 NMR studies and sequence similarities have shown the detailed structure and dynamics of micelle‒bound α‒synuclein in solution adopting a helical structure.14‒18 The 140‒amino acid sequence of α‒synuclein is divided into three regions: N‒terminal, central and C‒terminal.19,20 In vitro and cell‒based assays have shown diminished α‒synuclein oligomerization and fibrillogenesis when large segments within this motif are deleted.21‒23 Experimental studies also revealed three critical point mutations in the α‒synuclein gene: A53T, A30P, and E46K.24‒26 However, NMR spectroscopy revealed that mutation of A30P strongly attenuated the helical propensity found in the N‒terminal region of wild type α‒synuclein.27 The A30P mutation promoted α‒synuclein oligomer formation by introducing a kink on the second helix, which may impact its folding and/or normal function, while the A53T and E46K mutations promote fibrillation Highly conserved residues are indicated in red and variable sequences are indicated in yellow. Residues from 1-60 are indicated in black color box, 61-95 are indicated in violet color box and 96-140 are indicated in orange color box Figure 1. Previous simulations using the micelle‒bound NMR structure revealed the formation of α‒synuclein dimers, pentamers and hexamers in a ring like form.28 Truncated α‒synuclein (residues 1‒95) when bound to planar bilayers allows the protein to form a bent helix, with the largest bend around residue 47 due to the collective motions of the long helix. Computational methods also predicted the structure of the N‒terminal domain of α‒synuclein.29 Molecular Dynamics (MD) simulations of the NAC peptide using the replica exchange method under various conditions revealed that each individual conformation is highly flexible close to a random coil. However, simulations of the intermolecular beta sheets located between the residues 71‒82 indicate that anti‒parallel beta‒sheet conformers are stable at and above the 320K temperature. MD simulations also suggest that monomeric mutant forms of α‒synuclein in disease state do not show higher propensities for extended beta conformations than wild‒type α‒synuclein. Inter‒residue separation of monomeric α‒synuclein was measured at neutral and low pH ensembles using the single‒molecule fluorescence resonance energy transfer (sm FRET) method.30,31 These inter‒residue separations implemented in Monte Carlo simulations as constraints investigate the natively disordered ensemble of conformations using geometry (e.g., Bond length and bond angle) and repulsive Lennard‒Jones interactions. Conformational dynamics at 293K at neutral pH using all‒atom, united‒atom, and coarse‒grained methods show that the structure of α‒synuclein is intermediate between that for random walks and collapsed globules.32 Simulation studies at higher temperatures showed that fibril formation of α‒synuclein was substantially inhibited due to C‒terminal truncation and oligomer formation rather than conformation changes of the monomeric residues.33 Despite these significant recent advances, the mechanism of α‒synuclein aggregation and toxicity is still not understood in detail. In this study, the experimentally‒determined micelle‒bound structure of α‒synuclein (PDB code 1XQ8) consisting of two alpha helices linked by a long loop of 8 residues was downloaded from the Protein Data Bank Figure 2. The ion‒specific behavior of monovalent and divalent metal ions Na+, K+, Ca2+, Mand Zn2+ was investigated by means of extensive MD simulations of α‒synuclein in aqueous salt solutions. Earlier studies have reported that unfolding and aggregation of α‒synuclein differs in different salts, such as NaCl, KCl, MgCl2, CaCl2 and ZnCl2 at the same ionic concentration giving rise to its partial folding to the amyloidogenic conformation. To gain insights into the first steps of alpha‒synuclein unfolding and aggregation, MD simulations for alpha synuclein monomer and dimer were performed in the presence of water and in different salt concentrations at physiological pH using the OPLS force field with explicit water.

Figure 1 Scheme of -synuclein primary structure

Figure 2 Initial structures of human α-synuclein monomer (A) and dimer (B)

Methodology

The structure of α‒synuclein monomer was obtained from a Protein data bank (PDB:1XQ8) and its dimer was constructed using HEX protein docking software both forms of the protein were simulated by molecular dynamics and calibration methods with NAMD 2.5 software using the OPLS force field, along with the TIP3P model for explicit water at physiological pH. The simulations began with a 1000‒step minimization to remove any bad contacts between the designed side chains and solvent. A cut‒off of 12Å (switching function starting at 10Å) for vander Waals interactions was assumed. An integration time‒step of 2fs was used, permitting a multiple time‒stepping algorithm to be employed, in which interactions involving covalent bonds were computed every time step. Short‒range non‒bonded interactions were computed every two time‒step, and long‒range electrostatic forces were computed every four time‒steps. The pair list of the non‒bonded interactions was recalculated every ten time‒step with a pair list distance from 13.5Å. The short‒range non‒bonded interactions were defined as vander Waals and electrostatic interactions between particles within 12Å. A smoothing function was employed for the vander Waals interactions at a distance of 10Å. The backbone atoms were harmonically constrained with a restraining constant of 10 k cal/molÅ2, and the systems were heated to 310K over the course of 6ps at constant volume. The simulations were equilibrated for 2 ns with NVT ensemble (1atm, 310 K) while the harmonic constraints were gradually turned off. With no harmonic constraints, the simulations ran for 50 ns in the NVT ensemble using Langevin dynamics at a temperature of 310 K with a damping coefficient of g =5 ps‒1. Pressure was maintained at 1atm using the Langevin piston method with a piston period of 100fs, a damping time constant of 50fs and a piston temperature of 310K. Non‒bonded interactions were smoothly switched off from 10 to 12Å. The list of non‒bonded interactions was truncated at 14Å. Covalent bonds involving hydrogen were held rigid using the Shake algorithm, allowing a 2‒fs time‒step. No periodic boundary conditions were included in the above studies. Atomic coordinates were saved every 1ps for the trajectory analysis.

Results

MD simulations in the presence of NaCl

In the presence of NaCl, the negatively‒charged Cl‒ ions are attracted by the positively‒charged free amino groups with lysine’s located in the helices‒1 and 2 of α‒synuclein. These interactions destabilize the folded protein to unfold into four shorter helices from Figure 3A. However, the stability of these helices is not much affected in a protein dimer because of strong intermolecular interactions within the protein monomers in both N‒ and C‒terminal regions Figure 3B. This shows that sodium ions play a predominant role in keeping the protein dimer intact compared to protein monomers. With Ala30Pro mutant, the chloride ions don’t show any contacts with the protein residues. Out of 22Na+ only 7 ions show interaction with the negatively‒charged residues in the N‒terminal region of the protein. These fewer interactions of sodium ions unfold helices‒1 and 2 to form four shorter helices from Mdvfmkglskakegvvaaaektkeg, vvhgvatvaektkeqvtnv and avaqktve. The residues in the C‒terminal region don't show any intermolecular hydrogen bonds between the protein monomer Figure 3C. In the protein dimer, a slight unfolding near the residues EAP allowed the orientation of helices 1 and 2 towards each other forming the circular fold Figure 3D. Truncation of the C‒terminal region decreases the affinity with Na+ and Cl‒ ions in α‒synuclein monomer compared to dimer. The secondary structure, content shows a higher percentage of unfolding in the protein monomer with 66.4% compared to dimmer with 51.4%. Out of 10Na+, only 2 ions show interaction with the C‒terminal region of the protein.33‒40 The higher number of sodium ions interacting with the negatively charged residues in the N‒terminal region unfolds helix‒2 into three shorter helices from hgva, eqvt and gavvtgvtavaqktve Figure 3E. In the case of the protein dimer, the ionic interactions cause structural changes of one of the monomers by unfolding helix‒1 and helix‒2 into seven smaller helical fragments from fmkglskakegv, ktkqgvaea, egvv, tvaek, qvtnvggavvtg, vaqk and agsiaa. The Second Monomer Unfolds into Five shorter helices from vfmkglskakegvvaaaektkqgvaeaagk and kegv, atvae, gav and tavaqktvegagsiaaa. This unfolding allowed helix‒1 of the two monomers to approach very closely to the C‒terminal region of the protein Figure 3F. These results show that NaCl exerts greater influence on the unfolding of helix‒2 than helix‒1 in both the monomer and dimer of a‒synuclein.

Figure 3 Conformations of -synuclein wild type (Figure & B), mutant (Figure C & D) and truncated forms (Figure E & F) of both the monomer and dimer in the presence of NaCl, generated at 30 ns of simulated trajectory

MD simulations in the presence of KCl

Replacing NaCl with KCl allows the wild type monomer to show higher unfolded state with 78.6% compared to the dimer with 66.4% due larger size of the potassium ion compared to sodium. In total, 15K+ binds to a protein monomer showing hydrogen bond interactions with glutamic and aspartic residues, respectively. The chloride ion doesn’t show any hydrogen bonding interactions with the protein monomer. These ion‒protein interactions neutralize the negative charge of the protein by the larger potassium ions while the positively‒charged residues move freely in solution. The unfolding of the protein near the residues vvaa allowed helix‒1 to unfold into two smaller helical fragments of mdvfmkglskakeg and aaektq. Much of the helix‒2 is unfolded except in the regions tkeqv and avaqktve Figure 4A. In the case of the protein dimer 31K+ and 22 Cl‒ ions bind to protein surface neutralizing both the negative and positive charge of the protein causing structural changes at the end of helix‒1 by extending the loop between helix‒1 and helix‒2. The helix‒2 is unfolded into two shorter helices from kegvvhgvatvaektkeqvtn and avaqktve of monomer‒1 and from vvhgvatvaektkeq tgvtavaqk of the monomer‒2 Figure 4B. This showed that a higher percentage of unfolding is seen in the NAC region (61‒95) in both the monomer and dimer in the presence of KCl than in NaCl salt solution. The helical content of the mutant Ala30Pro decreases to 25.7% with 74.3% of unfolded protein compared to NaCl salt solution. The ionic interactions of protein monomer cause breaks in the helices‒1 and 2 to form smaller fragments of mkglskakegvvaaaekeapg, egvvhgvatvae and vaqk Figure 4C. In the protein dimer, both these helices do not undergo pronounced structural changes except at VV of one of the monomers, unfolding helix‒2 into two smaller fragments. This unfolding causes the orientation of helix‒2 very close to helix‒1 with a tight network of interactions creating the helical formation of the C‒terminal regions with the residues Dqlg and Pdne Figure 4D. This showed that KCl doesn’t exert great influence on the misfolding of the α‒synuclein dimer compared to the monomer in the N‒terminal helices. Truncated protein shows no affinity with K+ for the protein monomer but shows less affinity for the protein dimer with 10K+ ions bound to it. Both these forms of the protein showed affinity with chloride ions with 8 and 15Cl‒ ions, respectively. The secondary structure content showed higher percentage of unfolded regions in the monomer than dimer with 66.4% and 44.1% respectively. The protein monomer also showed 3.6% more of the beta sheet contents than dimer. Due to a higher number of chloride ions, the negative charge of the protein is mostly neutralized in both the forms of the protein. The positively‒charged residues are partially neutralised in the dimer while the residues move freely in the protein monomer. This causes the protein monomer to show a more visibly unfolded structure compared to the dimer. This unfolding of the protein monomer allowed helix‒1 to unfold into two smaller fragments of the residues from kglskakeg and ektk, eaagvvhgvatvaekte and avvt. This form of unfolding rearranges the C‒terminal region of the protein Ala and the to form an antiparallel beta sheet with Val and Lys Figure 4E. In the protein dimer, the helix‒1 of monomer‒1 does not unfold while it shows unfolding near the imperfect repeat egv of monomer‒2 into two shorter helices from vfmkglskak and vaaaektkqgvaeaagktk. The helix‒2 of both the monomers is broken down to three and two shorter helices from egvvhgvat, tkeq of monomer‒1 and from avvtgvtavaqktvegagsiaaa, kegvvhgvatvaektkeq and vtavaqktvegagsiaaa of monomer‒2. This form of folding creates a circular fold for the protein dimer Figure 4F. This showed that the truncation of the protein allowed helix‒1 to approach close to the C‒terminal region to form a tight network of interactions in both the forms of the protein.

Figure 4 Conformations of -synuclein wild type (Figure A & B), mutant (Figure C & D) and truncated forms (Figure E & F) of both the monomer and dimer in the presence of KCl, generated at 30 ns of simulated trajectory

MD simulations in the presence of CaCl2

In the presence of CaCl2, the content of secondary structure is higher by 66.4% in the protein monomer compared to the dimer with 44.3%. Out of the 27Ca2+ that binds to the protein monomer, only 5Ca2+ ions bind to the N‒terminal region of the protein while the rest of the Ca2+ ions show interactions with the C‒terminal region of the protein. Because of the influence of a large number of Ca2+ ions near the C‒terminal region of the protein, the residues Profaned Ser forms an anti‒parallel beta sheets with Tyr and Glen. The unfolding of the protein near the residues allowed helix‒1 to unfold into two helical fragments of mdvfmkglskake and aaektkqgv. Much of the helix‒2 is unfolded except in the regions Figure 5A. In the case of the dimer, the ionic interaction doesn’t show much influence on the protein unfolding, except the helix2 of one of the monomer is unfolded at the region Figure 5B. This show that Ca2+ has a much greater influence of the C‒terminal region compared to the rest of the protein in both the monomer and dimer of α‒synuclein. In the mutant Ala30Pro, the percentage of unfolding is shown with 27.9% of helix and 72.1% of loop content. In total, 21Ca2+ and 12Cl‒ ions bind to the surface of the protein showing ionic interactions with 16 glutamic and 5 aspartic acid residues. Out of the 21Ca2+ ions that bind to the protein monomer, six Ca2+ ions bind to the N‒terminal helix‒1 of the protein and three Ca2+ ions show interactions with the helix‒2 region of the protein. Most of the chloride ions interact with lysine residues in both the N‒ and C‒terminal regions of the protein neutralizing the positive charge of the protein. This ionic interaction of chloride ions influences the N‒terminal region of the helix‒1 to completely unfold into two shorter helices with the residues from aaektkqgvaeapgktk, hgvatvaektkeqvtnvggavvtg and ktvegagsiaaa. This unfolding allows an N‒terminal region of the helix‒1 to rearrange very close to the C‒terminal in a triangular form Figure 5C. In the protein dimer, the helix‒2 unfolds into two shorter helices with the residues from of monomer‒2. The residues in the C‒terminal region of the protein Glu and Glu form anti‒parallel beta sheets with Asp and Tyr Figure 5D. These results show that calcium ions exert much influence on the C‒terminal region of the protein in the formation of beta sheets. Truncated protein shows a decrease in the percentage of unfolding with 42.7% in the protein dimer compared to monomer with 44.5%. In total, 9Ca2+ and 16Cl‒ ions bind to the protein monomer while 24Ca2+ and 13Cl‒ ions bind to the protein dimer. The ionic interactions of Ca2+ do not show much influence on helix‒1 but influence helix‒2 to unfold into shorter helices from Vatvaekteqvt and avvtgvtavaqktvegag Figure 5E. In the protein dimer, the helices show unfolding near the residues in helix‒2 of one monomer‒1 and ggavvtgv of the other monomer‒2. This unfolding of helix‒2 into two helices from of the monomer‒2 Figure 5F. These results show that truncation of the protein exerts less influence on helix‒1 in protein unfolding in both the forms.

Figure 5 Conformations of -synuclein wild type (Figure A & B), mutant (Figure C & D) and truncated forms (Figure E & F) of both the monomer and dimer in the presence of CaCl2, generated at 30ns of simulated trajectory

MD simulations in the presence of MgCl2

Replacing CaCl2 with MgCl2 shows fewer Minds to the protein monomer and a greater number of Minds to the protein dimer in comparison to Ca2+ ions. The overall secondary structure content shows a higher percentage of unfolding for the protein monomer with 72.1% compared to the dimer. The helix‒1 of the protein monomer resists unfolding while helix‒2 unfolds into two shorter helices from Figure 6A. In the protein dimer, one of the monomers is highly unfolded into shorter fragments of and at the same time, the other monomer unfolds into four shorter helices with the residues from the residues in the C‒terminal region form anti‒parallel beta sheets with Figure 6B. These results suggest that CaCl2 and MgCl2 induce two opposing effects of compaction and unfolding on α‒synuclein depending on the divalent cation concentration. Thus, Ca2+ is more preferred to bind to an irregularly shaped C‒terminal over Mg2+. Interaction of metal ions with the protein also shows that these two ions, Mand Ca2+, exhibit negligible interactions with amino groups. That is, the determined stability constants of these metal ions with Asp only relate to interactions between metal ions and carboxyl groups. In the protein mutant, Ala30 Pro, the secondary structure content shows 25% of helix and 2.9% of the beta sheet. Out of 19Mg2+, 16Mions bind to the C‒terminal, 2 Miens bind to helix‒1 and one Mind to the carboxylate side chains of Glue and Asp. Fewer Miens binding to the N‒terminal allow helix‒1 and helix‒2 to unfold into two shorter helices from Figure 6C. In the protein dimer, the helix‒1 of monomer‒1 does not unfold while it shows unfolding near the residues in helix‒1 of monomer‒2. The helix‒2 of both the monomers bends to a V shape without unfolding and create inter molecular interactions in the C‒terminal region of the protein Figure 6D. Truncated protein shows 46.4% of helix and 53.6% of unfolded protein with 0% of the beta sheet. Out of 19Mg2+, 4 ions bind to the N‒terminal while the rest bind to the carboxylate side chains of Glutamic acid. Fewer Miens binding to the N‒terminal do not influence much the conformational changes of helix‒1 while they unfold helix‒2 into two shorter helices from Figure 6E. In the protein dimer, the helix‒1 of one of the monomers does not unfold while it shows unfolding near the residues of the other monomer unfolding helix‒1 into three helices from. The helix‒2 of both the monomers is unfolded to four and two helices from Figure 6F. These results show that helix‒1 shows a different behavior in these two forms of the protein.

Figure 6 Conformations of -synuclein wild type (Figure A & B), mutant (Figure C & D) and truncated forms (Figure E & F) of both the monomer and dimer in the presence of MgCl2, generated at 30ns of simulated trajectory

MD simulations in the presence of ZnCl2

In the presence of ZnCl2, the secondary structure content of monomer shows a higher percentage of unfolding with 65.7% compared to the dimer with 61.4%. In total, 14Zn2+ and 25Zn2+ ions bind to the protein monomer and dimer, respectively. The interactions of chloride ions with the positively‒charged amino acids influence helix‒1 of the protein monomer to unfold into two shorter helices from Figure 7A. In the case of the protein dimer, monomer‒1 undergoes structural changes in the N‒terminal helix‒1 by breaking the helix into two shorter helices from. The helix‒2 becomes unfolded, giving rise to three shorter helices from. The N‒terminal helix of the monomer‒2 doesn’t undergo pronounced structural changes while the helix‒2 unfolds to form three shorter helices from Figure 7B. The mutant α‒synuclein shows 37.1% of helix and 62.9% of unfolded regions with 0% of the beta sheet. Out of six Zn2+, four Zn2+ binds to the C‒terminal and the two ions bind to the N‒terminal. These ionic interactions of chloride ions with the positively‒charged amino acids influence helix‒1 to break into three shorter helices from. Moreover, helix‒2 is unfolded into three smaller helices from Figure 7C. In the protein dimer, the helix‒1 of both monomers does not unfold while it shows unfolding near the residues in helix‒2 of the both the monomers. This folding bends helix‒2 to a V shape, arranging both the helices very close to each other Figure 7D. Finally, the truncated protein decreases the affinity with Zn2+ and Cl‒ with 7Zn2+ and 5Cl‒ ions. These ionic interactions of Zn2+ with the negatively‒charged amino acids influence helix‒1 to unfold into two shorter helices from. Moreover, helix‒2 is broken down into two smaller helices from Figure 7E. In the protein dimer, the helix‒1 of one of the monomers does not unfold while it shows unfolding near the imperfect repeats of the other monomer unfolding the helix‒1 into three shorter helices from. The helix‒2 of both the monomers is unfolded to two and three helices from of one monomer of the other monomer. This form of folding creates a triangular fold for the protein dimer Figure 7F.

Figure 7 Conformations of -synuclein wild type (Figure A & B), mutant (Figure C & D) and truncated forms (Figure E & F) of both the monomer and dimer in the presence of ZnCl2, generated at 30ns of simulated trajectory

Discussion

Overall, there are slightly strong affinities with Na+ and K+ ions with negatively‒charged residues of α‒synuclein compared to Ca2+, Mand Zn2+ based on the number of captions interacting with α‒synuclein dimer, mutant monomer and mutant dimer Table 1. Since, Ca2+, Mand Zn2+ possesses different radii with similarity in charges, their affinity and coordination number between them and α‒synuclein appears to be different. Ca2+ ions bind mainly to the oxygen of carbonyl groups of residues in proteins. The binding sites for these metal ions are situated in the region of the oxygen atoms of Asp and Glue residues mainly through a C=O group in a protein, which can result in the conformational transition from a helix to a sheet or turn species. This conformational stability of α‒synuclein varies with different metal ions based on their characteristic features. From Table 2 it is clear that Zn2+ shows higher stability in both wild and mutant forms of the protein, while Ca2+ increased the stability of a truncated form of the monomer. The other metal ion, Shows high influence in enhancing the stability of truncated form but destabilizes the mutant form compared to wild type with 2.9% of the β‒sheet. In comparison to NaCl, KCl decreases the stability of all the three forms of the protein showing much influence on protein aggregation in the truncated form with 3.6% of the β‒sheet compared to mutant with 2.9%. These results show that effect of α‒synuclein aggregation is seen high in the truncated form compared to other forms of the protein. Previous data on experimental studies of human α‒synuclein truncation from 1‒87, 1‒102, 1‒110, 1‒119 and 1‒120 showed a faster rate of aggregation compared to full length and mutant protein. Moreover, partially truncated α‒synuclein has been detected in dementia patients with Lewy body (DLBs) brains, glial cytoplasmic inclusions (GCIs) of multiple system atrophy (MSA) and abnormal neurites of Alzheimer’s disease without LBs38, suggesting that C‒terminal truncations may play a role in the aggregation of α‒synuclein.These results also show that, the unfolding of the protein monomer is reduced in the presence of MgCl2 by 27.9%, and 25% of the wild and mutant forms, respectively. However, decreased unfolding was seen in the presence of KCl with truncated form of protein monomer. In the dimeric form, the unfolding is less pronounced in the presence of CaCl2 by 55.5%, 57.5% and 57.3%, respectively, in all the three forms of the protein Table 3. Interestingly, the unfolding of α‒synuclein monomer in the presence of K+ ions increases substantially, compared to other metal ions presumably due to the loss of the coordination bonds. This loss of hydrophobic and hydrogen‒bond interactions rearranges the α‒synuclein to more compact conformations with favorable long‒range electrostatic interactions. Based on the change in the secondary structure content of α‒synuclein monomer, Na+, and K+ ions decrease the stability of the helix in the unfolding process of wild and truncated forms. In comparison, only K+ ions decrease the percentage of helical content of Ala30Pro mutant equally to Mg2+. This is due to the presence of Na+, and K+ ions between the helices at the loops destabilize the helix structure while the ionic interactions of Ca2+, Mand Zn2+ ions increase the helix structure by stabilizing the hydrogen bonds. Overall, the results also show that binding of Ca2+, Mand K+ ions with α‒synuclein wild, mutant and truncated forms of the monomer will influence the aggregation rate of α‒synuclein with 2.9% of the beta sheet in CaCl2, Mg Cl2 and 3.6% in KCl Table 2. It has been proposed that the aggregation of α‒synuclein inside the neurons can be influenced by the increased intra‒cytoplasmic Ca2+ concentration.41,42 In addition, the interaction of α‒synuclein with the cell membranes was modulated by Ca2+. The absence of Ca2+ allows α‒synuclein to interact with lipid membranes via the N‒terminal domain. The additional interaction between the membrane and the C‒terminal domain can be enhanced by the addition of Ca2+, which may lead to aggregation of this protein. For Ca2+ ions, there are many strong‒binding sites in the surface residues (Asp or Glue) of α‒synuclein, which influences the stability of the tertiary structure. In addition, the results obtained for the wild type dimer reveals that KCl shows a significant effect in unfolding, while ZnCl2 and NaCl shows almost equal effect on the protein dimer stability in all the three forms Table 3. However, CaCl2 showed much influence on protein aggregation in mutant (A30P) dimer. Recent evidences also show that the toxicity of the oligomerized α‒synuclein can be abolished by preventing the Ca2+ influx through removal of extracellular Ca2+. The finding also supports the fact that β sheet‒rich oligomerized species are the most toxic species in cells, and that this toxicity is crucially dependent on Ca2+ dysregulation.43 Furthermore, MgCl2 decreases the stability of wild type and truncated forms of the dimer, while it shows equal effect along with NaCl in the mutant form of the protein. Mutation of Ala30pro clearly shows that both the monovalent and divalent cations decrease the stability of α‒synuclein in both the forms of the protein. These results show that binding of these metal ions with positively‒ and negatively‒charged residues disturbs the secondary structure content of the protein by breaking the helices 1 and 2 into smaller helices. This breakage of alpha helices differs with different salt concentrations in all the three types of the protein in both the monomer and dimer. In all these salts except MgCl2, the residues in the N‒terminal helix‒1 from are highly stable without undergoing any structural changes in the rest of the wild type monomer. But in the case of the mutant protein, the N‒terminal helix‒1 is highly disturbed undergoing a structural helix‒to‒flexible loop transition. When the residues from 110‒140 regions are truncated, the residues in the N‒terminal helix‒1 are highly disturbed undergoing a structural transition from helix‒1 to flexible loops in the presence of NaCl, MgCl2 and ZnCl2 with the exception of CaCl2 enhancing the stability of helix‒1. However, with KCl, the N‒terminal helix‒1 forms antiparallel beta sheet as shown in Figure 4E. These results predict that in both the mutant and truncated forms, the N‒terminal helix‒1 undergoes a less pronounced structural transition compared to the wild type. The orientation of the affected residues in the N‒terminal helix‒1 differs with different salts. In MgCl2 and ZnCl2, the helix‒1 is oriented away from the rest of the protein without showing any contacts with the protein while the orientation is very close to other helices in the presence of other salts showing very strong intra‒molecular hydrogen bonds. This orientation of helix‒1 reveals that aggregation of α‒synuclein in the presence of MgCl2 and ZnCl2 is less pronounced compared to NaCl, KCl and CaCl2. AFM (Atomic Force Microscopy) images show that α‒synuclein fibrils prepared for lower concentrations of NaCl have a ribbon‒like morphology, while those prepared in higher concentrations are twisted and rod‒like.44 In the form of dimer, MgCl2 showed a high effect of unfolding of alpha helices in both wild and truncated forms, while ZnCl2 showed effects on Ala30Pro mutant Table 3. Thus, it can be stated that Na+, and K+ ions weaken the conformational stability of α‒synuclein wild type and truncated forms of the monomer, while Ca2+ and Zn2+ ions enhance the conformational stability in all the three forms Table 1. However, shows different effect on different forms of the protein. These ions show the opposite effect in the form of protein dimer indicating that the loss of solvent‒exposed surface of the α‒synuclein is greater in the unfolding process than that about α‒synuclein without metal ions Table 2. Studies also show that the propensity for the Leu‒substituted α‒synuclein to oligomerized is decreased in the presence of ZnCl2, indicating the influence of Zn2+ on the fibrillation pathway to α‒synuclein.45 A recent study made a compelling argument with the involvement of zinc dyshomeostasis as a trigger for Alzheimer disease which is involved in both beta amyloid aggregation and taupathy.46 It is entirely plausible that zinc and other metal ions play a substantial role in other neurodegenerative diseases such as Parkinson’s.47 Thus, these results suggest that unfolding of α‒synuclein differs in different salt concentrations due to the influence of different metal ions at the C‒terminal and N‒terminal residues predicting to be the two major binding sites of α‒synuclein. Previously, the results indicate that Participates in the coordination with NH2 while Ca2+ coordinates with COO‒. Also, proton shift changes at pH above 8 upon coordination of Asp with Miss much greater in solutions with Ca2+. In addition, Na+ is more strongly attracted to the protein surface than K+. This is primarily due to interactions with COO‒ side chain groups of Asp and Glu.48 Experimental studies reveal that the binding site‒1 of α‒synuclein is driven by the electrostatic interactions of the negatively‒charged side chains with metal ions and is mostly directed towards the C‒terminal domain of the protein. The metal‒binding site‒2 has been assigned to several N‒terminal residues and to the imidazole ring of the sole histamine residue.49 Experimental studies support this statement by demonstrating that the C‒terminus of α‒synuclein also contain a specific, albeit low‒affinity, metal binding site. The binding of the metal ion at this sequence is not only influenced by electrostatic interactions, but also by the residues of the C‒terminal portion of the α‒synuclein. These propensities for the metal ion induce partial folding of the non‒oxidized α‒synuclein and promote the formation of fibrillation.50,51 Among the most effective stimulators Cu2+ and Fe2+ ions interact specially with α‒synuclein while Al3+, Co3+, and Mn2+ interact non‒specifically and influence partial folding of the protein and subsequent fibrillation.51 The interaction of these metal ions in different ways of α‒synuclein induces a wide range of structural changes in the native conformation of α‒synuclein. These structural changes vary from an ordered structure of residues to a globule‒like conformation in the presence of some monovalent metals and later promoted by interaction with polyvalent ions. These structural and morphological changes of partially folded monomeric and dimeric forms can assemble into different oligomers and fibrils.

Monomer WT

Monomer Mutant

Monomer Truncated

Dimer WT

Dimer Mutant

Dimer Truncated

Size of box, X,Y,Z dimensions

10x20

10x20

10x20

10x20

10x20

10x20

Number of water molecules in box Water/Metal ratio

9238

9244

8270

9216

9217

9068

17.7

14.4

23.7

16.3

12.3

18.8

14.4

16.6

12.5

NaCl,

521

644

348

564

748

482

Number of Na ions

512

635

350

546

730

487

Number of Cl ions

9

9

-2

18

18

-5

KCl,

521

644

348

564

748

482

Number of K ions

512

635

350

546

590

487

Number of Cl ions

9

9

-2

18

18

-5

CaCl2,

642

640

348

555

739

483

Number of Ca ions

1275

1271

698

1092

1460

970

Number of Cl ions

9

9

-2

18

18

-4

MgCl2,

642

640

348

555

739

483

Number of Mg ions

1275

1271

698

1092

1460

970

Number of Cl ions

9

9

-2

18

18

-4

ZnCl2,

642

640

348

555

739

483

Number of Zn ions

1275

1271

698

1092

1460

970

Number of Cl ions

9

9

-2

18

18

-4

Table 1 α-synuclein and salts simulation data

Salt

%Helix

%Sheet

%Loop

Number of Ions

NaCl

27.1

0

72.9

29Na+, 5Cl-

KCl

21.4

0

78.6

15K+, 11Cl-

CaCl2

30.7

2.9

66.4

27Ca2+, 11Cl-

MgCl2

27.9

0

72.1

23Mg2+, 12Cl-

ZnCl2

34.3

0

65.7

14Zn2+, 13Cl-

Ala30Pro

NaCl

32.9

0

67.1

22Na+, 1Cl-

KCl

25.7

0

74.3

11K+, 5Cl-

CaCl2

31.4

0

68.6

21Ca2+, 12Cl-

MgCl2

25

2.9

72.1

19Mg2+, 14Cl-

ZnCl2

37.1

0

62.9

6Zn2+, 11Cl-

Truncation

NaCl

33.6

0

66.4

10Na+, 8Cl-

KCl

30

3.6

66.4

0K+, 8Cl-

CaCl2

55.5

0

44.5

9Ca2+, 16Cl-

MgCl2

46.4

0

53.6

10Mg2+, 7Cl-

ZnCl2

39.1

0

60.9

7Zn2+, 5Cl-

Table 2 Secondary structure content for the 30ns simulated structure of α-synuclein monomer predicted using 2struc server

Salt

%Helix

%Sheet

%Loop

Number of Ions

NaCl

40.7

0

59.3

53Na+, 7Cl-

KCl

33.6

0

66.4

31K+, 22Cl-

CaCl2

55.7

0

44.3

35Ca2+, 13Cl2-

MgCl2

32.1

0

67.9

38Mg2+, 17Cl2-

ZnCl2

38.6

0

61.4

25Zn2+, 20Cl-

Ala30Pro                                           

NaCl

53.2

0

46.8

40Na+, 7Cl-

KCl

57.9

0

42.1

19K+, 11Cl-

CaCl2

57.5

1.4

41.1

41Ca2+, 5Cl-

MgCl2

53.2

0

46.8

37Mg2+, 11Cl-

ZnCl2

51.4

0

48.6

0Zn2+, 9Cl-

Truncation                     

NaCl

48.6

0

51.4

30Na+, 19Cl-

KCl

55.9

0

44.1

10K+, 15Cl-

CaCl2

57.3

0

42.7

24Ca2+, 13Cl-

MgCl2

47.7

0

52.3

16Mg2+, 14Cl-

ZnCl2

48.2

0

51.8

25Zn2+, 20Cl-

Table 3 Secondary structure content for the 30ns simulated structure of α-synuclein dimer predicted using 2struc server

Conclusion

In summary, the influence of metal ions (Na+, K+, Ca2+, Mg2+, Zn2+) on the folding pathway and conformational stability of α‒synuclein has been studied using computer simulations. In the presence of Zn2+ ions, the unfolding processes of α‒synuclein show an equal effect compared to the unfolding process of α‒synuclein in the presence of other salts. However, Shows different effect on different form of the protein dimer, in comparison to Na+, and K+ which shows equal effect in maintaining the protein stability. Although the Ca2+ maintains higher stability in the wild type and truncated forms is more prone to aggregation in a mutant form of the dimer. The construction of ion‒binding sites in proteins is important to the design of proteins with high thermo‒stability. Therefore, the effects of metal ions on various aspects of proteins determined by the complicated interactions between the metal ions and residues deserve further study. The clinical implications of these results are important to both the design of future inhibitors of α‒synuclein oligomerization as well as for disease prevention involving metal ion effects on the brain.

Acknowledgements

I thank Prof. Maria Stepanova for providing the laboratory facilities and helpful discussions.

Conflicts of interest

No potential conflict of interest was reported by the authors.

References

  1.  Dobson CM. Protein folding and misfolding. Nature. 2003;426(6968):884‒890.
  2. Ross CA, Poirier MA. Protein aggregation and neurodegenerative disease. Nature medicine. 2004;(10):10‒17.
  3. Lashuel HA, Labrenz SR, Woo L, et al. Protofilaments, filaments, ribbons, and fibrils from peptidomimetic self‒assembly: implications for amyloid fibril formation and materials science. Journal of the American Chemical Society. 2000;122(22):5262‒5277.
  4. Spillantini MG, Schmidt ML, Lee VM, et al. Alpha‒synuclein in Lewy bodies. Nature. 1997;388(6645):839‒840.
  5. Shults CW. Lewy bodies. Sciences of the United States of America. 2006;103(6):1661‒1668.
  6. Skovronsky DM, Lee VM, Trojanowski JQ. Neurodegenerative diseases: new concepts of pathogenesis and their therapeutic implications. Annu Rev Pathol. 2006;(1):151‒170.
  7. Chiti F, Dobson CM. Protein misfolding, functional amyloid, and human disease. Annu Rev Biochem. 2006;(75):333‒366.
  8. Eliezer D, Kutluay E, Bussell R, et al. Conformational properties of alpha‒synuclein in its free and lipid‒associated states. Journal of molecular biology. 2001;307(4):1061‒1073.
  9. Uversky VN, Li J, Fink AL. Evidence for a partially folded intermediate in alpha‒synuclein fibril formation. The Journal of biological chemistry. 2001;276(14):10737‒10744.
  10. Uversky VN, Oldfield CJ, Dunker AK. Intrinsically disordered proteins in human diseases: introducing the D2 concept. Annu Rev Biophys. 2008;(37):215‒246.
  11. Dunker AK, Lawson JD, Brown CJ, et al. Intrinsically disordered protein. Journal of molecular graphics & modelling. 2001;19(1):26‒59.
  12. Uversky VN. Natively unfolded proteins: a point where biology waits for physics. Protein science. 2002;11(4):739‒756.
  13. Uversk VN. A protein‒chameleon: conformational plasticity of alpha‒synuclein, a disordered protein involved in neurodegenerative disorders. Journal of biomolecular structure & dynamics. 2003;21(2):211‒234.
  14. Maroteaux L, Campanelli JT, Scheller RH. Synuclein: a neuron‒specific protein localized to the nucleus and presynaptic nerve terminal. The Journal of neuroscience: the official. Journal of the Society for Neuroscience. 1988;8(8):2804‒2815.
  15. Ulmer TS, Bax A, Cole NB, et al. Structure and dynamics of micelle‒bound human alpha‒synuclein. The Journal of biological chemistry. 2005;280(10):9595‒9603.
  16. George JM, Jin H, Woods WS, et al. Characterization of a novel protein regulated during the critical period for song learning in thezebra finch. Neuron. 1995;15(2):361‒372.
  17. Davidson WS, Jonas A, Clayton DF, et al. Stabilization of alpha‒synuclein secondary structure upon binding to synthetic membranes. The Journal of biological chemistry. 1998;273(16):9443‒9449.
  18. Bussell R, Eliezer D. A structural and functional role for 11‒mer repeats in alpha‒synuclein and other exchangeable lipid binding proteins. Journal of molecular biology. 2003;329(4):763‒778.
  19. Han H, Weinreb PH, Lansbury PT. The core Alzheimer's peptide NAC forms amyloid fibrils which seed and are seeded by beta‒amyloid: is NAC a common trigger or target in neurodegenerative disease? Chemistry & biology. 1995;2(3):163‒169.
  20. Ueda K, Fukushima H, Masliah E, et al. Molecular cloning of cDNA encoding an unrecognized component of amyloid in Alzheimer disease. Sciences of the United States of America. 1993;90(23):11282‒11286.
  21. El‒Agnaf OM, Jakes R, Curran MD, et al. Effects of the mutations Ala30 to Pro and Ala53 to Thr on the physical and morphological properties of alpha‒synuclein protein implicated in Parkinson's disease. FEBS letters. 1998;440(2):67‒70.
  22. Giasson BI, Murray IV, Trojanowski JQ, et al. A hydrophobic stretch of 12 amino acid residues in the middle of alpha‒synuclein is essential for filament assembly. The Journal of biological chemistry. 2001;276(4):2380‒2386.
  23. Luk KC, Song C, Brien P, et al. Exogenous alpha‒synuclein fibrils seed the formation of Lewy body‒like intracellular inclusions in cultured cells. Sciences of the United States of America. 2009;106(47):20051‒20056.
  24. Polymeropoulos MH, Lavedan C, Leroy E, et al. Mutation in the alpha‒synuclein gene identified in families with Parkinson's disease. Science. 1997;276(5321):2045‒2047.
  25. Zarranz JJ, Alegre J, Gomez‒Esteban JC, et al. The new mutation, E46K, of alpha‒synuclein causes Parkinson and Lewy body dementia. Annals of neurology. 2004;55(2):164‒173.
  26. Kruger R, Kuhn W, Muller T, et al. Ala30Pro mutation in the gene encoding alpha‒synuclein in Parkinson's disease. Nature genetics. 1998;18(2):106‒108.
  27. Bussell R, Eliezer D. Residual structure and dynamics in Parkinson's disease‒associated mutants of alpha‒synuclein. The Journal of biological chemistry. 2001;276(49):45996‒6003.
  28. Tsigelny IF, Bar‒On P, Sharikov Y, et al. Dynamics of alpha‒synuclein aggregation and inhibition of pore‒like oligomer development by beta‒synuclein. The FEBS journal. 2007;274(7):1862‒1877.
  29. Mihajlovic M, Lazaridis T. Membrane‒bound structure and energetics of alpha‒synuclein. Proteins. 2008;70(3):761‒778.
  30. Yoon J, Jang S, Lee K, et al. Simulation studies on the stabilities of aggregates formed by fibril‒forming segments of alpha‒Synuclein. Journal of biomolecular structure & dynamics. 2009;27(3):259‒270.
  31. Trexler AJ, Rhoades E. Single molecule characterization of alpha‒synuclein in aggregation‒prone states. Biophysical journal. 2010;99(9):3048‒3055.
  32. Smith WW, Schreck CF, Hashem N, et al. Molecular simulations of the fluctuating conformational dynamics of intrinsically disordered proteins. Phys Rev E Stat Nonlin Soft Matter Phys. 2012;86(4):041910.
  33. Ariesandi W, Chang CF, Chen TE, et al. Temperature‒dependent structural changes of Parkinson's alpha‒synuclein reveal the role of pre‒existing oligomers in alpha‒synuclein fibrillization. Plos one. 2013;8(1):e53487.
  34. Crowther RA, Jakes R, Spillantini MG, et al. Synthetic filaments assembled from C‒terminally truncated alpha‒synuclein. FEBS letters. 1998;436(3):309‒312.
  35. Serpell LC, Berriman J, Jakes R, et al. Fiber diffraction of synthetic alpha‒synuclein filaments shows amyloid‒like cross‒beta conformation. National Academy of Sciences. 2000;97(9):4897‒4902.
  36. Murray IV, Giasson BI, Quinn SM, et al. Role of alpha‒synuclein carboxy‒terminus on fibril formation in vitro. Biochemistry. 2003;42(28):8530‒8540.
  37. Liu CW, Giasson BI, Lewis KA, et al. A precipitating role for truncated alpha‒synuclein and the proteasome in alpha‒synuclein aggregation: implications for pathogenesis of Parkinson disease. The Journal of biological chemistry. 2005;280(24):22670‒22678.
  38. Lewis KA, Su Y, Jou O, et al. Abnormal neurites containing C‒terminally truncated alpha‒synuclein are present in Alzheimer's disease without conventional Lewy body pathology. The American journal of pathology. 2010;177(6):3037‒3050.
  39. Baba M, Nakajo S, Tu PH, et al. Aggregation of alpha‒synuclein in Lewy bodies of sporadic Parkinson's disease and dementia with Lewy bodies. The American journal of pathology. 1998;152(4):879‒884.
  40. Anderson JP, Walker DE, Goldstein JM, et al. Phosphorylation of Ser‒129 is the dominant pathological modification of alpha‒synuclein in familial and sporadic Lewy body disease. The Journal of biological chemistry. 2006;281(40):29739‒29752.
  41. Gai WP, Power JH, Blumbergs PC, et al. Alpha‒synuclein immunoisolation of glial inclusions from multiple system atrophy brain tissue reveals multiprotein components. Journal of neurochemistry. 1999;73(5):2093‒2100.
  42. Pountney DL, Voelcker NH, Gai WP. Annular alpha‒synuclein oligomers are potentially toxic agents in alpha‒synucleinopathy. Hypothesis. Neurotoxicity research. 2005;7(2):59‒67.
  43. Angelova PR, Ludtmann MH, Horrocks MH, et al. Ca2+ is a key factor in alpha‒synuclein‒induced neurotoxicity. J Cell Sci 2016;129(9):1792‒1801.
  44.   Roeters SJ, Iyer A, Pletikapic G, et al. Evidence for Intermolecular Antiparallel Beta‒Sheet Structure in Alpha‒Synuclein Fibrils from a Combination of Two‒Dimensional Infrared Spectroscopy and Atomic Force Microscopy. Scientific reports. 2017;(7):41051. <
  45.   Hokenson MJ, Uversky VN, Goers J, et al. Role of individual methionines in the fibrillation of methionine‒oxidized alpha‒synuclein. Biochemistry. 2004;43(15):4621‒4633.
  46. Craddock TJ, Tuszynski JA, Chopra D, et al. The zinc dyshomeostasis hypothesis of Alzheimer's disease. Plos one. 2012;7(3):e33552.
  47. Sayre LM, Moreira PI, Smith MA, et al. Metal ions and oxidative protein modification in neurological disease. Ann Ist Super Sanita. 2005;41(2):143‒164.
  48. Kozlowski H, Swiatek J, Siatecki Z. 1H NMR studies on interactions of calcium and magnesium with aspartic acid and asparagine. Acta biochimica Polonica. 1981;28(1):1‒9.
  49. Binolfi A, Lamberto GR, Duran R, et al. Site-specific interactions of Cu (II) with alpha and beta-synuclein: bridging the molecular gap between metal binding and aggregation. Journal of the American Chemical Society. 2008;130(35):11801‒11812.
  50. Binolfi A, Rasia RM, Bertoncini CW, et al. Interaction of alpha‒synuclein with divalent metal ions reveals key differences: a link between structure, binding specificity and fibrillation enhancement. Journal of the American Chemical Society. 2006;128(30):9893‒9901.
  51. Uversky VN, Li J, Fink AL. Metal‒triggered structural transformations, aggregation, and fibrillation of human alpha‒synuclein. A possible molecular NK between Parkinson's disease and heavy metal exposure. The Journal of biological chemistry. 2001;276(47):44284‒44296.

Creative Commons Attribution License

©2018 Pagadala. This is an open access article distributed under the terms of the, which permits unrestricted use, distribution, and build upon your work non-commercially.